Histone-binding protein required for histone H4 methyltransferase activity of PRMT5. Specifically required for histone H4 'Arg-3' methylation mediated by PRMT5, but not histone H3 'Arg-8' methylation, suggesting that it modulates the substrate specificity of PRMT5. Specifically interacts with the N-terminus of histone H4 but not with histone H3, suggesting that it acts by promoting the association between histone H4 and PRMT5. Involved in CCNE1 promoter repression (By similarity). MDPPTAGAQSLGAAEQPRGLQLPSGREAPPSPGTAFAPADHSSQEKATENATDRLANGAQSIPHDSPAHGEGTHCEEEGFAEDDEDSDGEPSPWELSEGMSGCLPKEQAGDLFHEDWDLELKADQGNPYDADDIQGCLSQEVRPWVCCAPQGDMIYDPSWHHPPPLIPHYSKMVFETGQFDDAED Cooperator of PRMT5 185 COPR5 COPR5_BOVIN